Nano'nun Günlüğü…

Ideallerimi gerceklestirmek icin arastiriyorum, Unutmamak icin yaziyorum!

  • Bulundugunuz Sayfa: 
  • Ana Sayfa
  • BioInformatic Assignments

BioInformatic Assignments

Gönderim Haziran 17th, 2014

Biyoinformatik alaninda calismaniz icin ornek niteliginde isinize yarayabilecek soru ve cevaplari bu makale iceriginde bulabilirsiniz.

 

 

Assignment I

A ) Human Myoglobin Protein Hakkinda Bilgiler

clear all;

close all;

clc;

% Human Myoglobin.Fasta

seqMg = fastaread(‘humanMyoglobin.fasta’)

seqMG = seqMg.Sequence

seqMg =

Header: ‘gi|44955888|ref|NP_976312.1| myoglobin [Homo sapiens]’

Sequence: [1×154 char]

seqMG =

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFK

HLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATK

HKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNY

KELGFQG

B ) Mouse Myoglobin Protein Hakkinda Bilgiler

clear all;

close all;

clc;

% Mouse Myoglobin.Fasta

seqMg = fastaread(‘mouseMyoglobin.fasta’)

seqMG = seqMg.Sequence

seqMg =

Header: ‘gi|255708425|ref|NP_001157520.1| myoglobin [Mus musculus]’

Sequence: [1×154 char]

seqMG =

MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKN

LKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI

PVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG

C ) Human Myoglobin Proteini ve Mouse Myoglobin Proteini arasindaki farkliliklar

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFK

HLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATK

HKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASN

YKELGFQG

MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFK

NLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATK

HKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYK

ELGFQG

Assignment II

Q : YECHQCGQAFKT
P : YECNQCGKAFR

Global Alignment  Score : 43

Gap : -1
Y    E    C    H    Q    C    G    Q    A    F    K    T
Y    7    -2    -2    2    -1    -2    -3    -1    -2    3    -2    -2
E    -2    5    -4    0    2    -4    -2    2    -1    -3    1    -1
C    -2    -4    9    -3    -3    9    -3    -3    0    -2    -3    -1
N    -2    0    -3    1    0    -3    0    0    -2    -3    0    0
Q    -1    2    -3    0    5    -3    -2    5    -1    -3    1    -1
C    -2    -4    9    -3    -3    9    -3    -3    0    -2    -3    -1
G    -3    -2    -3    -2    -2    -3    6    -2    0    -3    -2    -2
K    -2    1    -3    -1    1    -3    -2    1    -1    -3    5    -1
A    -2    -1    0    -2    -1    0    0    -1    4    -2    -1    0
F    3    -3    -2    -1    -3    -2    -3    -3    -2    6    -3    -2
R    -2    0    -3    0    1    -3    -2    1    -1    -3    2    -1

Local Alignment  Score :

Match = +5 , Mismatch = -2,  Gap : -1

Y    E    C    N    Q    C    G    K    A    F    R
0    0    0    0    0    0    0    0    0    0    0    0
Y    0    4    3    2    1    0    0    0    0    0    0    0
E    0    3    8    7    6    5    4    3    2    1    0    0
C    0    2    7    12    11    10    9    8    7    6    5    4
H    0    1    6    11    10    9    8    7    6    5    4    3
Q    0    0    5    10    9    14    13    12    11    10    9    8
C    0    0    4    9    8    13    18    17    16    15    14    13
G    0    0    3    8    7    12    17    22    21    20    19    18
Q    0    0    2    7    6    11    16    21    20    19    18    17
A    0    0    1    6    5    10    15    20    19    24    23    22
F    0    0    0    5    4    9    14    19    18    23    28    27
K    0    0    0    4    3    8    13    18    23    22    27    26
T    0    0    0    3    2    7    12    17    22    21    26    25

 

Q : GCGCATGGATTGAGCGA
P : TGCGCCATTGATGACCA

A    T    C    G
A    5    -4    -4    -4
T    -4    5    -4    -4
C    -4    -4    5    -4
G    -4    -4    -4    5

Global Alignment   Score : 5 , Gap : -1

G    C    G    C    A    T    G    G    A    T    T    G    A    G    C    G    A
T    -4    -4    -4    -4    -4    5    -4    -4    -4    5    5    -4    -4    -4    -4    -4    -4
G    5    -4    5    -4    -4    -4    5    5    -4    -4    -4    5    -4    5    -4    5    -4
C    -4    5    -4    5    -4    -4    -4    -4    -4    -4    -4    -4    -4    -4    5    -4    -4
G    5    -4    5    -4    -4    -4    5    5    -4    -4    -4    5    -4    5    -4    5    -4
C    -4    5    -4    5    -4    -4    -4    -4    -4    -4    -4    -4    -4    -4    5    -4    -4
C    -4    5    -4    5    -4    -4    -4    -4    -4    -4    -4    -4    -4    -4    5    -4    -4
A    -4    -4    -4    -4    5    -4    -4    -4    5    -4    -4    -4    5    -4    -4    -4    5
T    -4    -4    -4    -4    -4    5    -4    -4    -4    5    5    -4    -4    -4    -4    -4    -4
T    -4    -4    -4    -4    -4    5    -4    -4    -4    5    5    -4    -4    -4    -4    -4    -4
G    5    -4    5    -4    -4    -4    5    5    -4    -4    -4    5    -4    5    -4    5    -4
A    -4    -4    -4    -4    5    -4    -4    -4    5    -4    -4    -4    5    -4    -4    -4    5
T    -4    -4    -4    -4    -4    5    -4    -4    -4    5    5    -4    -4    -4    -4    -4    -4
G    5    -4    5    -4    -4    -4    5    5    -4    -4    -4    5    -4    5    -4    5    -4
A    -4    -4    -4    -4    5    -4    -4    -4    5    -4    -4    -4    5    -4    -4    -4    5
C    -4    5    -4    5    -4    -4    -4    -4    -4    -4    -4    -4    -4    -4    5    -4    -4
C    -4    5    -4    5    -4    -4    -4    -4    -4    -4    -4    -4    -4    -4    5    -4    -4
A    -4    -4    -4    -4    5    -4    -4    -4    5    -4    -4    -4    5    -4    -4    -4    5

Local Alignment  Score :

Match = +5 , Mismatch = -4,  Gap : -4

–    –    T    G    C    G    C    C    A    T    T    G    A    T    G    A    C    C    A
–    0    0    0    0    0    0    0    0    0    0    0    0    0    0    0    0    0    0
G    0    0    5    1    5    1    0    0    0    0    5    1    0    5    1    0    0    0
C    0    0    1    10    6    10    6    2    0    0    1    1    0    1    1    6    5    1
G    0    0    5    6    15    11    7    3    0    0    5    1    0    5    1    2    2    1
C    0    0    1    10    11    20    16    12    8    4    1    1    0    1    1    6    7    3
A    0    0    0    6    7    16    16    21    17    13    9    6    2    0    6    2    3    12
T    0    5    1    2    3    12    12    17    26    22    18    14    11    7    3    2    0    8
G    0    1    10    6    7    8    8    13    22    22    27    23    19    16    12    8    4    4
G    0    0    6    6    11    7    4    9    18    18    27    23    19    24    20    16    12    8
A    0    0    2    2    7    7    3    9    14    14    23    32    28    24    29    25    21    17
T    0    5    1    0    3    3    3    5    14    19    19    28    37    33    29    25    21    17
T    0    5    1    0    0    0    0    1    10    19    15    24    33    33    29    25    21    17
G    0    1    10    6    5    1    0    0    6    15    24    20    29    38    34    30    26    22
A    0    0    6    6    2    1    0    5    2    11    20    29    25    34    43    39    35    31
G    0    0    5    2    11    7    3    1    1    7    16    25    25    30    39    39    35    31
C    0    0    1    10    7    16    12    8    4    3    12    21    21    26    35    44    44    40
G    0    0    5    6    15    12    12    8    4    0    8    17    17    26    31    40    40    40
A    0    0    1    2    11    11    8    17    13    9    5    13    13    22    31    36    36    45

Assignment III

S1 : ALSK
S2 : TNSD
S3 : NASK
S4 : NLSD
MATCH : +5
MISMATCH :-3
GAP : -1

Dizi en yuksek score: 5

–  T  N  S  D
–  0  0  0  0
A  0  0  0  0
L  0  0  0  0
S  0  0  5  4
K  0  0  4  3

S S     Dizi en yuksek score: 14

–  N  A  S  K
–  0  0  0  0
A  0  5  4  3
L  0  4  3  2
S  0  3  9  8
K  0  2  8  14

K K    Dizi en yuksek score: 10

–  N  L  S  D
–  0  0  0  0
A  0  0  0  0
L  0  5  4  3
S  0  4  10  9
K  0  3  9  8

S S    Dizi en yuksek score: 9

–  N  A  S  K
–  0  0  0  0
T  0  0  0  0
N  5  4  3  2
S  4  3  9  8
D  3  2  8  7

S S    Dizi en yuksek score: 14

–  N  L  S  D
–  0  0  0  0
T  0  0  0  0
N  5  4  3  2
S  4  3  9  8
D  3  2  8  14

D D    Dizi en yuksek score: 8

–  N  L  S  D
–  0  0  0  0
N  5  4  3  2
A  4  3  2  1
S  3  2  8  7
K  2  1  7  6

S S

0 5 14 10 29
5 0 9 14 28
14 9 0 8 31
10 14 8 0 32    En buyuk degere sahip sequence’ler :
29 S1, 28 S2, 31 S3, 32 S4
Selection Sort sonucu buyukten kucuge siralama :
32 S4, 31 S3, 29 S1, 28 S2    Tree MAP :
S4—|____
S3—|
S1——-|_____
S2—|_________|

S1: AACCTG
S2: CCAGTA
S3: GAATTC
S4: TCCCTG    MATCH : +5
MISMATCH :-3
GAP : -1

Dizi en yuksek score: 13

–  C  C  A  G  T  A
–  0  0  0  0  0  0
A  0  0  5  4  3  5
A  0  0  5  4  3  8
C  5  5  4  3  2  7
C  5  10  9  8  7  6
T  4  9  8  7  13  12
G  3  8  7  13  12  11

T T    Dizi en yuksek score: 13

–  G  A  A  T  T  C
–  0  0  0  0  0  0
A  0  5  5  4  3  2
A  0  5  10  9  8  7
C  0  4  9  8  7  13
C  0  3  8  7  6  12
T  0  2  7  13  12  11
G  5  4  6  12  11  10

C C    Dizi en yuksek score: 20

–  T  C  C  C  T  G
–  0  0  0  0  0  0
A  0  0  0  0  0  0
A  0  0  0  0  0  0
C  0  5  5  5  4  3
C  0  5  10  10  9  8
T  5  4  9  9  15  14
G  4  3  8  8  14  20

G G    Dizi en yuksek score: 9

–  G  A  A  T  T  C
–  0  0  0  0  0  0
C  0  0  0  0  0  5
C  0  0  0  0  0  5
A  0  5  5  4  3  4
G  5  4  4  3  2  3
T  4  3  3  9  8  7
A  3  9  8  8  7  6

T T    Dizi en yuksek score: 13

–  T  C  C  C  T  G
–  0  0  0  0  0  0
C  0  5  5  5  4  3
C  0  5  10  10  9  8
A  0  4  9  9  8  7
G  0  3  8  8  7  13
T  5  4  7  7  13  12
A  4  3  6  6  12  11

G G    Dizi en yuksek score: 10

–  T  C  C  C  T  G
–  0  0  0  0  0  0
G  0  0  0  0  0  5
A  0  0  0  0  0  4
A  0  0  0  0  0  3
T  5  4  3  2  5  4
T  5  4  3  2  7  6
C  4  10  9  8  7  6

C C

0 13 13 20 46
13 0 9 13 35
13 9 0 10 32
20 13 10 0 43    En buyuk degere sahip sequence’ler :
46 S1, 35 S2, 32 S3, 43 S4
Selection Sort sonucu buyukten kucuge siralama :
46 S1, 43 S4, 35 S2, 32 S3    Tree MAP :
S1—|____
S4—|
S2——-|_____
S3—|_________|

Assignment IV

Suffix Tree : YECHQCQE
3: CHQCQE
6: CQE
8: E
2: ECHQCQE
4: HQCQE
5: QCQE
7: QE
1: YECHQCQE
|(1:YECHQCQE)|leaf
tree:|
|(2:ECHQCQE)|leaf
|
|     |(4:HQCQE)|leaf
|(3:C)|
|     |(7:QE)|leaf
|
|(4:HQCQE)|leaf
|
|     |(6:CQE)|leaf
|(5:Q)|
|     |(8:E)|leaf
3 branching nodes

Assignment V

Suffix Tree : mississippi$

T1  = mississippi = txt
T2  = ississippi
T3  = ssissippi
T4  = sissippi
T5  = issippi
T6  = ssippi
T7  = sippi
T8  = ippi
T9  = ppi
T10 = pi
T11 = i
T12 = $    T11 = i
T8  = ippi
T5  = issippi
T2  = ississippi
T1  = mississippi
T10 = pi
T9  = ppi
T7  = sippi
T4  = sissippi
T6  = ssippi
T3  = ssissippi

tree                          substrings

tree–>|—mississippi                m .. mississippi
|
|—i–>|—ssi–>|—ssippi   i .. ississippi
|       |         |
|       |         |—ppi      issip,issipp,issippi
|       |
|       |—ppi                ip, ipp, ippi
|
|—s–>|—si–>|—ssippi    s .. ssissippi
|       |        |
|       |        |—ppi       ssip, ssipp, ssippi
|       |
|       |—i–>|—ssippi     si .. sissippi
|               |
|               |—ppi        sip, sipp, sippi
|
|—p–>|—pi                 p, pp, ppi
|
|—i                  p, pi

Keyifli Calismalar Dilerim.

Etiketler: , , ,
Bulundugu Konu Etiketleri Akademik, BioInformatic, Matlab, Yazilim |

Lutfen Yorumlarinizi Burdan Ulastiriniz!...

You must be Kullanici Adiniz : to post a comment.

Istatistik

  • 1 Uye
  • 334 Yazi
  • 16 Yorum Var