Nano'nun Günlüğü…

Ideallerimi gerceklestirmek icin arastiriyorum, Unutmamak icin yaziyorum!

  • Bulundugunuz Sayfa: 
  • Ana Sayfa
  • Java ile Protein Dizisi Hizalama

Java ile Protein Dizisi Hizalama

Gönderim Mayıs 5th, 2014

Bu makalemde basit bir mantikla protein zincirlerlerinde hizalamalari java yardimiyla eslestirmeye calisicaz.

Yapilan bu calisma ile ayni zamanda java’da string kontrollerini pekistirmis olucaksiniz.

Calisma sonucunda ornek olarak kullanabileceginiz protein dizilimleride bulabilirsiniz.

Java Kodu

public class align {

public static void main(String[] args) {
String[] aligned = align(“PTHPLASKTQILPEDLASEDLTI”, “PTHPLAGERAIGLARLAEEDFGM”);
System.out.println(aligned[0]);
System.out.println(aligned[1]);
}

public static String[] align(String a, String b) {
int[][] T = new int[a.length() + 1][b.length() + 1];

for (int i = 0; i <= a.length(); i++)
T[i][0] = i;

for (int i = 0; i <= b.length(); i++)
T[0][i] = i;

for (int i = 1; i <= a.length(); i++) {
for (int j = 1; j <= b.length(); j++) {
if (a.charAt(i – 1) == b.charAt(j – 1))
T[i][j] = T[i – 1][j – 1];
else
T[i][j] = Math.min(T[i – 1][j], T[i][j – 1]) + 1;
}
}

StringBuilder aa = new StringBuilder(), bb = new StringBuilder();

for (int i = a.length(), j = b.length(); i > 0 || j > 0; ) {
if (i > 0 && T[i][j] == T[i – 1][j] + 1) {
aa.append(a.charAt(–i));
bb.append(“-“);
} else if (j > 0 && T[i][j] == T[i][j – 1] + 1) {
bb.append(b.charAt(–j));
aa.append(“-“);
} else if (i > 0 && j > 0 && T[i][j] == T[i – 1][j – 1]) {
aa.append(a.charAt(–i));
bb.append(b.charAt(–j));
}
}
return new String[]{aa.reverse().toString(), bb.reverse().toString()};
}
}

Ekran Ciktisi

PTHPLA—-SKTQI-L–PEDLASE-D—LTI
PTHPLAGERA—-IGLAR—LA-EEDFGM—

Ornek Protein Dizilimleri

Protein Zincir Ornekleri;

String aminoAcid1 = “PTHPLASKTQILPEDLASEDLTI”;
String aminoAcid2 = “PTHPLAGERAIGLARLAEEDFGM”;

String aminoAcid1 = “GMIDLITARCAYPSWTGH”;
String aminoAcid2 = “IEVRTAKCAYPGWSGHY”;

String aminoAcid1 = “GEIMAASRIETYKEDAQVWIGDLPCWLADYGYWDLPKRAVGRRYRIIAGGQPVIITTEYF”;
String aminoAcid2 = “GEVMAASCIETFKEEAKVWAGESPAWLELDRRRNLPPKVVGRQYRVIAEGRPVIIITEYF”;

String aminoAcid1 = “DVAPKIPELENLKIGRILQRDILLKGQKSGILFVAAESLIVIDLLPTAITTYLTKTHHPI”;
String aminoAcid2 = “DAAPEMDGCDHSSIGRVLRRDIVLKGRRSGIPFVAAESFIAIDLLPPEIVASLLETHRPI”;

String aminoAcid1 = “MTNRTLSREEIRKLDRDLRILVATNGTLTRVLNVVANEEIVVDIINQQLLDVAPKIPELE”;
String aminoAcid2 = “MTECHLSDEEIRKLNRDLRILIATNGTLTRILNVLANDEIVVEIVKQQIQDAAPEMDGCD”;

String aminoAcid1 = “NLKIGRILQRDILLKGQKSGILFVAAESLIVIDLLPTAITTYLTKTHHPIGEIMAASRIE”;
String aminoAcid2 = “HSSIGRVLRRDIVLKGRRSGIPFVAAESFIAIDLLPPEIVASLLETHRPIGEVMAASCIE”;

String aminoAcid1 = “TYKEDAQVWIGDLPCWLADYGYWDLPKRAVGRRYRIIAGGQPVIITTEYFLRSVFQDTPR”;
String aminoAcid2 = “TFKEEAKVWAGESPAWLELDRRRNLPPKVVGRQYRVIAEGRPVIIITEYFLRSVFEDNSR”;

String aminoAcid1 = “EELDRCQYSNDIDTRSG”;
String aminoAcid2 = “EEPIRHQRSVGTSARSG”;

Keyifli Calismalar Dilerim.

Etiketler: , , , , ,
Bulundugu Konu Etiketleri Akademik, BioInformatic, Java, Yazilim |

Lutfen Yorumlarinizi Burdan Ulastiriniz!...

You must be Kullanici Adiniz : to post a comment.

Istatistik

  • 1 Uye
  • 334 Yazi
  • 16 Yorum Var