Nano'nun Günlüğü…

Ideallerimi gerceklestirmek icin arastiriyorum, Unutmamak icin yaziyorum!

  • Bulundugunuz Sayfa: 
  • Ana Sayfa
  • Global ve Local Alignment

Global ve Local Alignment

Gönderim Mart 21st, 2014

Hizalama turleri kullanilan algoritmalarina gore Global ve Local Alignment’lar olarak ikiye ayrilmaktadir.

Global alignment; Needleman & Wunsch algoritmasini kullanir.

Local alignment ise Smith & Waterman algoritmasini kullanmaktadir.

Global dizilimde aminoacid string uzunluklarini benzer buyuklukte ve benzer yapidaki genlere olmasina dikkat edilir. Genis bir sonuc olacak sekilde aminoacid’lerin dizilisi ortaya cikmaktadir.

Local dizilimde aminoacid string uzunluklari farkli uzunluklarda olabilir. Sonuc olarak bu uzunluklar arasinda benzer bolgeleri alip dizilime sokacaktri.

National Center for Biotechnology Information ‘a ait olan http://www.ncbi.nlm.nih.gov adresinden global ve local bir sekilde dizilim yaparken calisacagimiz proteinler olan Hemoglobin ve Herpes ‘e ait FASTA uzantili dosyalari asagidaki gibi oncelikle search ettiriyoruz.

 

 

Ardindan cikan sonuclardan en son eklenen protein’i seciyoruz.

 

 

 

 

 

 

 

 

Download formatini fasta olarak sectikten sonra indirmis oldugumuz .fasta uzantili dizilimlerimizi matlabimizde okutturmuya ve ardindan da global ve local dizilim sonuclarini elde etmeye calisiyoruz.

Matlab Kodu;

clear all;
close all;
clc;

seqHg = fastaread(‘hemoglobin.fasta’)
seqHerpes = fastaread(‘herpes.fasta’)
seqHG = seqHg.Sequence;
seqH = seqHerpes.Sequence;

% Global Alignment
[score alignment] = nwalign(seqH,seqHG)

% Local Alignment
[score alignment] = swalign(seqH,seqHG)

Sonuclar;

Hemoglobin.Fasta

>gi|109893891|gb|ABG47031.1| hemoglobin [Homo sapiens]
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG
AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR

Herpes.Fasta

>gi|83754653|pdb|2C56|A Chain A, A Comparative Study Of Uracil Dna Glycosylases From Human And Herpes Simplex Virus Type 1
MDLTNGGVSPAATSAPLDWTTFRRVFLIDDAWRPLMEPELANPLTAHLLAEYNRRCQTEEVLPPREDVFS
WTRYCTPDEVRVVIIGQNPYHHPGQAHGLAFSVRANVPPPPSLRNVLAAVKNCYPEARMSGHGCLEKWAR
DGVLLLNTTLTVKRGAAASHSRIGWDRFVGGVIRRLAARRPGLVFMLWGTHAQNAIRPDPRVHCVLKFSN
PSPLSKVPFGTCQHFLVANRYLETRSISPIDWSV

seqHg =
Header: ‘gi|109893891|gb|ABG47031.1| hemoglobin [Homo sapiens]’
Sequence: [1×105 char]

seqHerpes =
Header: [1×121 char]
Sequence: [1×244 char]

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Keyifli Calismalar Dilerim.

Etiketler: , , , , , ,
Bulundugu Konu Etiketleri Akademik, BioInformatic, Matlab, Yazilim |

Gecici Bir Sure Icin; Bu Konu Yorumlara Kapalidir, Tesekkurler!...

Istatistik

  • 1 Uye
  • 334 Yazi
  • 16 Yorum Var